Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEARSQPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDS FLLRFLRARDFDLDLAWRLLKNYYKWRAECPEISADLHPRSIIGLLKAGY HGVLRSRDPTGSKVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQ RNGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEP VIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEF SMEDICQEWTNFIMKSEDYLSSISESIQ
    • Amino acids
      1 to 278
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-tocopherol transfer protein
    • Alpha-TTP
    • AlphaTTP
    • ATTP
    • AVED
    • Tocopherol (alpha) transfer protein (ataxia (Friedreich-like) with vitamin E deficiency)
    • TTP1
    • TTPA
    • TTPA_HUMAN
    see all
  • Function
    Binds alpha-tocopherol and enhances its transfer between separate membranes.
  • Involvement in disease
    Defects in TTPA are the cause of ataxia with isolated vitamin E deficiency (AVED) [MIM:277460]. AVED is an autosomal recessive disease characterized by spinocerebellar degeneration. It causes ataxia and peripheral neuropathy that resembles Friedreich ataxia. AVED patients have markedly reduced plasma levels of vitamin E.
  • Sequence similarities
    Contains 1 CRAL-TRIO domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159756 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up