Recombinant Human Tubby like protein 4 (ab163458)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGN GRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLATC DADGGIFVWIQYEGRWSVELVNDRGAQVSDFTWSHDGTQALISYRDGFVL VGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRM LAHVLLHESDGVLGMSWNYPIFLVEDSSESDTDSDDYAPPQDGPAAYPIP VQNIKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLA VAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICW GHRDSRLLMASGPALYVVRVEHRVSSLQLLCQQAIASTLREDKDVSKLTL PPRLCSYLSTAFIPTIKPPIPDPNNMRDFVSYPSAGNERLHCTMKRTEDD PEVGGPCYTLYLEYLGGLVPILKGRRISKLRPEFVIMDPRTDSKPDEIYG NSLISTVIDSCNCSDSSDIELSDDWAAKKSPKISRASKSPKLPRISIEAR KSPKLPRAAQELSRSPRLPLRKPSVGSPSLTRREFPFEDITQHNYLAQVT SNIWGTKFKIVGLAAFLPTNLGAVIYKTSLLHLQPRQMTIYLPEVRKISM DYINLPVFNPNVFSEDEDDLPGDAVWTD
    • Amino acids
      1 to 678
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1397
    • RP3 442A17.1
    • Tubby related protein 4
    • Tubby super family protein
    • Tubby superfamily protein
    • TUBL 4
    • TUBL4
    • TULP 4
    • TULP4
    • TUSP
    see all
  • Relevance
    Tubby like protein 4 is a novel gene belonging to the tubby superfamily proteins (TUSP). The protein sequences of these genes are 40-48% identical to other tubby family proteins at the C-terminal conserved 'tubby domain'. The TUSP proteins also contain a tubby signature motif (FXGRVTQ), two bipartite nuclear localization signals (NLSs) at the C-terminal, one WD40 repeat region, one suppressor of cytokines signaling domain and two proline-rich regions. The precise biological function of the tubby superfamily genes is still unknown. However the highly conserved tubby domain in different species suggests that these proteins must have fundamental biological functions in a wide range of multi-cellular organisms.
  • Cellular localization
    Cytoplasmic

Images

  • ab163458 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up