Overview

  • Product nameRecombinant Human TUBG1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23258
    • SpeciesHuman
    • SequenceMPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDV FFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGA GNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLG SYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNAD CVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMN NDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRK REAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQE Q
    • Molecular weight76 kDa including tags
    • Amino acids1 to 452

Specifications

Our Abpromise guarantee covers the use of ab112367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesab112367 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • Gamma-1-tubulin
    • Gamma-tubulin complex component 1
    • GCP-1
    • TBG1_HUMAN
    • TUBG
    • TUBG1
    • TUBGCP1
    • Tubulin gamma-1 chain
    • Tubulin, gamma 1
    • Tubulin, gamma polypeptide
    see all
  • FunctionTubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.
  • Sequence similaritiesBelongs to the tubulin family.
  • Cellular localizationCytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Recombinant Human TUBG1 protein images

  • ab112367 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human TUBG1 protein (ab112367)

ab112367 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"