Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANP DASPWLWRSCLREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCG GDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELEEVSVENGSVS PPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMD GDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDS DHMRHEASLAIRSPCPGLEEDMEAYVLRPALPGTMMQCYLTRDKHGVDKG LFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDNFV GKVRSNVFSTKFTIFDNGVNPDREHLTRNTARIRQELGAVCYEPNVLGYL GPRKMTVILPGTNSQNQRINVQPLNEQESLLSRYQRGDKQGLLLLHNKTP SWDKENGVYTLNFHGRVTRASVKNFQIVDPKHQEHLVLQFGRVGPDTFTM DFCFPFSPLQAFSICLSSFN
    • Amino acids
      1 to 520
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer testis antigen 65
    • Cancer/testis antigen 65
    • CT65
    • MGC107290
    • Pdet
    • Protein P4-6
    • Tubby like protein 2
    • Tubby related protein 2
    • Tubby-like protein 2
    • Tubby-related protein 2
    • TUBL 2
    • TUBL2
    • TULP 2
    • TULP2
    • TULP2_HUMAN
    see all
  • Tissue specificity
    Strongly expressed in testis. Also expressed in retina. Expressed in cancer cell lines.
  • Sequence similarities
    Belongs to the TUB family.
  • Cellular localization
    Cytoplasm. Secreted. Does not have a cleavable signal peptide and is secreted by a non-conventional pathway.
  • Information by UniProt

Images

  • ab159761 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up