Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFSQDNDTLMRDILGHELAAMRL QKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDRGL GNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLG LQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPG TRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREA SESTGTNSSAAHNEELSKALKGEGGTDSDHMRHEASLAIRSPCPGLEEDM EAYVLRPALPGTMMQCYLTRDKHGVDKGLFPLYYLYLETSDSLQRFLLAG RKRRRSKTSNYLISLDPTHLSRDGDNFVGKVRSNVFSTKFTIFDNGVNPD REHLTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRINVQ PLNEQESLLSRYQRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASV KNFQIVDPKHQEHLVLQFGRVGPDTFTMDFCFPFSPLQAFSICLSSFN
    • Molecular weight
      62 kDa including tags
    • Amino acids
      2 to 520
    • Additional sequence information
      Expressed with a small T7-His-TEV cleavage site Tag (29aa) at its N-terminal as inclusion bodies. (NP_003314)

Specifications

Our Abpromise guarantee covers the use of ab190405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    sterile-filtered, contains NaCl, KCl, EDTA, arginine, DTT and Sucrose.

General Info

  • Alternative names
    • Cancer testis antigen 65
    • Cancer/testis antigen 65
    • CT65
    • MGC107290
    • Pdet
    • Protein P4-6
    • Tubby like protein 2
    • Tubby related protein 2
    • Tubby-like protein 2
    • Tubby-related protein 2
    • TUBL 2
    • TUBL2
    • TULP 2
    • TULP2
    • TULP2_HUMAN
    see all
  • Tissue specificity
    Strongly expressed in testis. Also expressed in retina. Expressed in cancer cell lines.
  • Sequence similarities
    Belongs to the TUB family.
  • Cellular localization
    Cytoplasm. Secreted. Does not have a cleavable signal peptide and is secreted by a non-conventional pathway.
  • Information by UniProt

References

ab190405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up