Overview

  • Product name
    Recombinant Human TULP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQ PNPEARLRRAKPRASDEQTPLVNCHTPHSNVILHGIDGPAAVLKPDEVHA PSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSA CLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGV TVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYL ISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTR QELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRW QNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPD YIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE
    • Amino acids
      1 to 442
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC45295
    • Tubby like protein 3
    • Tubby related protein 3
    • Tubby-like protein 3
    • Tubby-related protein 3
    • TUBL 3
    • TUBL3
    • TULP 3
    • TULP3
    • TULP3_HUMAN
    see all
  • Function
    Negatively regulates SHH signal transduction (By similarity). Probably functions in signal transduction from heterotrimeric G protein-coupled receptors. Binds to phosphorylated inositide lipids.
  • Tissue specificity
    Expressed at high levels in testis, ovaries, thyroid, and spinal chord.
  • Sequence similarities
    Belongs to the TUB family.
  • Cellular localization
    Nucleus. Cell membrane. Cell projection > cilium. Cytoplasm. Secreted. Does not have a cleavable signal peptide and is secreted by a non-conventional pathway (By similarity). Translocates from the plasma membrane to the nucleus upon activation of guanine nucleotide-binding protein G(q) subunit alpha.
  • Information by UniProt

Images

  • ab159763 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up