Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15672
    • SpeciesHuman
    • SequencePQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTL KLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMS ASH
    • Molecular weight40 kDa including tags
    • Amino acids100 to 202

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesab112368 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • ACS3
    • B-HLH DNA binding protein
    • bHLHa38
    • BPES2
    • BPES3
    • Class A basic helix-loop-helix protein 38
    • CRS1
    • H-twist
    • OTTHUMP00000116043
    • SCS
    • TWIST
    • Twist basic helix loop helix transcription factor 1
    • Twist homolog 1
    • Twist homolog 1 (Drosophila)
    • TWIST homolog of drosophila
    • Twist related protein 1
    • Twist-related protein 1
    • TWIST1
    • TWST1_HUMAN
    see all
  • FunctionActs as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation.
  • Tissue specificitySubset of mesodermal cells.
  • Involvement in diseaseDefects in TWIST1 are a cause of Saethre-Chotzen syndrome (SCS) [MIM:101400]; also known as acrocephalosyndactyly type 3 (ACS3). SCS is a craniosynostosis syndrome characterized by coronal synostosis, brachycephaly, low frontal hairline, facial asymmetry, hypertelorism, broad halluces, and clinodactyly.
    Defects in TWIST1 are the cause of Robinow-Sorauf syndrome (RSS) [MIM:180750]; also known as craniosynostosis-bifid hallux syndrome. RSS is an autosomal dominant defect characterized by minor skull and limb anomalies which is very similar to Saethre-Chotzen syndrome.
    Defects in TWIST1 are the cause of craniosynostosis type 1 (CRS1) [MIM:123100]. Craniosynostosis consists of premature fusion of one or more cranial sutures, resulting in an abnormal head shape.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Twist protein images

  • ab112368 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Twist protein (ab112368)

ab112368 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"