Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIE FYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINAL PTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMS SMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMI FVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEE AESKEGTNKDFPQNAIRQRSLGPSLATDKS
    • Amino acids
      1 to 280
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PDIA11
    • Protein disulfide isomerase family A, member 11
    • Thioredoxin domain containing
    • Thioredoxin domain containing 1
    • Thioredoxin domain-containing protein 1
    • Thioredoxin-related transmembrane protein 1
    • TMX
    • TMX1
    • TMX1_HUMAN
    • Transmembrane Trx-related protein
    • TXNDC
    • TXNDC1
    see all
  • Function
    May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.
  • Tissue specificity
    Ubiquitous. Highly expressed in kidney, liver, placenta and lung.
  • Sequence similarities
    Contains 1 thioredoxin domain.
  • Cellular localization
    Membrane. Endoplasmic reticulum membrane. Predominantly found in the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab164331 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up