Recombinant Human TXNDC15 protein (ab194018)

Overview

  • Product name
    Recombinant Human TXNDC15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VEVAEESGRLWSEEQPAHPLQVGAVYLGEEELLHDPMGQDRAAEEANAVL GLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAEDSRCNVRESLFS LDGAGAHFPDREEEYYTEPEVAESDAAPTEDSNNTESLKSPKVNCEERNI TGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNS LPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDR TLETLKIFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDHHHHHH
    • Molecular weight
      33 kDa including tags
    • Amino acids
      33 to 321
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab194018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names
    • 2310047H23Rik
    • AI854086
    • C5orf14
    • Disulfide isomerase
    • FLJ22625
    • MGC109343
    • OTTHUMP00000223117
    • RGD1304696
    • Thioredoxin domain containing 15
    • Thioredoxin domain-containing protein 15
    • TXD15_HUMAN
    • Txndc15
    • UNQ335
    • UNQ335/PRO534
    see all
  • Sequence similarities
    Contains 1 thioredoxin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab194018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up