Recombinant Human TXNDC4 protein (ab185850)

Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEF PNENQVVFARVDCDQ HSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI QEIRDLAEITTLDRS KRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNI IYKPPGHSAPDMVYL GAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTE SLEIFQNEVARQLIS EKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVL IPGKLKQFVFDLHSG KLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDVD HHHHHH
    • Molecular weight
      44 kDa including tags
    • Amino acids
      30 to 402
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Assessed also by SEC-HPLC
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 10% Glycerol

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Endoplasmic reticulum resident protein 44
    • Endoplasmic reticulum resident protein 44 kDa
    • Endoplasmic reticulum resident protein ERp44
    • ER protein 44
    • ERp44
    • ERP44_HUMAN
    • KIAA0573
    • PDIA10
    • Protein disulfide isomerase family A, member 10
    • Thioredoxin domain containing 4 (endoplasmic reticulum)
    • Thioredoxin domain containing protein 4
    • Thioredoxin domain-containing protein 4
    • UNQ532/PRO1075
    see all
  • Function
    Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
  • Sequence similarities
    Contains 1 thioredoxin domain.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

References

ab185850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up