Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMEITSLDTENIDE ILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVD CDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKS DPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAF LSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKC VPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEK GTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIP GKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLA PSEYRYTLLRDRDEL
    • Molecular weight
      48 kDa including tags
    • Amino acids
      30 to 406
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99218 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • Endoplasmic reticulum resident protein 44
    • Endoplasmic reticulum resident protein 44 kDa
    • Endoplasmic reticulum resident protein ERp44
    • ER protein 44
    • ERp44
    • ERP44_HUMAN
    • KIAA0573
    • PDIA10
    • Protein disulfide isomerase family A, member 10
    • Thioredoxin domain containing 4 (endoplasmic reticulum)
    • Thioredoxin domain containing protein 4
    • Thioredoxin domain-containing protein 4
    • UNQ532/PRO1075
    see all
  • Function
    Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
  • Sequence similarities
    Contains 1 thioredoxin domain.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99218.

References

ab99218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up