Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BS26
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMEITSLDTENIDE ILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVD CDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKS DPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAF LSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKC VPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEK GTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIP GKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLA PSEYRYTLLRDRDEL
    • Molecular weight48 kDa including tags
    • Amino acids30 to 406
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99218 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • Endoplasmic reticulum resident protein 44
    • Endoplasmic reticulum resident protein 44 kDa
    • Endoplasmic reticulum resident protein ERp44
    • ER protein 44
    • ERp44
    • ERP44_HUMAN
    • KIAA0573
    • PDIA10
    • Protein disulfide isomerase family A, member 10
    • Thioredoxin domain containing 4 (endoplasmic reticulum)
    • Thioredoxin domain containing protein 4
    • Thioredoxin domain-containing protein 4
    • UNQ532/PRO1075
    see all
  • FunctionMediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
  • Sequence similaritiesContains 1 thioredoxin domain.
  • Cellular localizationEndoplasmic reticulum lumen.
  • Information by UniProt

Recombinant Human TXNDC4 protein images

  • 15% SDS-PAGE analysis of 3µg ab99218.

References for Recombinant Human TXNDC4 protein (ab99218)

ab99218 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"