Overview

  • Product name
    Recombinant Human TXNL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVGVKPVGSDPDFQPELSGAGSRLAVVKFT MRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFL FFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFI NKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSM KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGI VPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKR VVGKKGESH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 289
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103050 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 32 kDa thioredoxin related protein
    • 32 kDa thioredoxin-related protein
    • Thioredoxin like 1
    • Thioredoxin like 32kD
    • Thioredoxin like 32kDa
    • Thioredoxin like protein 1
    • Thioredoxin related 32 kDa protein
    • Thioredoxin-like protein 1
    • TRP 32
    • TRP32
    • TRxL
    • TXL
    • TXL 1
    • TXL1
    • TXN L1
    • TXNL
    • TXNL 1
    • Txnl1
    • TXNL1_HUMAN
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 PITH domain.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human TXNL1 protein images

  • 15% SDS-PAGE analysis of 3µg ab103050

References for Recombinant Human TXNL1 protein (ab103050)

ab103050 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up