Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFGSMAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSL LVVHFWAPWAPQCA QMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYE ISSVPTFLFFKNSQKIDRLDGAHAPELTKK VQRHASSGSFLPSANEHL KEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQ FS SFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDT ICPKAPKLEERL KVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTG VEYETFDILEDEEVRQGLKAYSNWPTYP QLYVKGELVGGLDIVKELKE NGELLPILRGEN
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 335
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169921 was expressed in E.coli as inclusion bodies then refolded using “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Buffer contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • glrx3
    • GLRX3_HUMAN
    • GLRX4
    • Glutaredoxin 3
    • Glutaredoxin 4
    • Glutaredoxin-3
    • GRX3
    • GRX4
    • PICOT
    • PKC interacting cousin of thioredoxin
    • PKC theta interacting protein
    • PKC-interacting cousin of thioredoxin
    • PKC-theta-interacting protein
    • PKCq interacting protein
    • PKCq-interacting protein
    • Thioredoxin like protein 2
    • Thioredoxin-like protein 2
    • TXNL3
    see all
  • Function
    Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (By similarity). May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity.
  • Tissue specificity
    Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
  • Sequence similarities
    Contains 2 glutaredoxin domains.
    Contains 1 thioredoxin domain.
  • Domain
    The thioredoxin domain lacks the two redox-active cysteines. This strongly suggests that it lacks thioredoxin activity.
  • Cellular localization
    Cytoplasm > cell cortex. Cytoplasm > myofibril > sarcomere > Z line. Under the plasma membrane. After PMA stimulation, GLRX3 and PRKCQ/PKC-theta translocate to a more extended submembrane area. In the Z line, found associated with CSRP3.
  • Information by UniProt

References

ab169921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up