Recombinant Human TXNL4B protein (ab108121)

Overview

  • Product name
    Recombinant Human TXNL4B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEV DQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVD QTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFID LIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 149
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab108121 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AI595343
    • D530025J19Rik
    • Dim1 like protein
    • Dim1-like protein
    • DIM2
    • DLP
    • FLJ20511
    • MGC109322
    • RGD1305127
    • Thioredoxin like 4B
    • Thioredoxin like protein 4B
    • Thioredoxin-like protein 4B
    • TXN4B_HUMAN
    • Txnl4b
    see all
  • Function
    Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.
  • Sequence similarities
    Belongs to the DIM1 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108121.

References

ab108121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up