Recombinant Human TXNL4B protein (ab108121)

Overview

  • Product nameRecombinant Human TXNL4B protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NX01
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEV DQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVD QTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFID LIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
    • Molecular weight21 kDa including tags
    • Amino acids1 to 149
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab108121 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AI595343
    • D530025J19Rik
    • Dim1 like protein
    • Dim1-like protein
    • DIM2
    • DLP
    • FLJ20511
    • MGC109322
    • RGD1305127
    • Thioredoxin like 4B
    • Thioredoxin like protein 4B
    • Thioredoxin-like protein 4B
    • TXN4B_HUMAN
    • Txnl4b
    see all
  • FunctionEssential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.
  • Sequence similaritiesBelongs to the DIM1 family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TXNL4B protein images

  • 15% SDS-PAGE analysis of 3µg ab108121.

References for Recombinant Human TXNL4B protein (ab108121)

ab108121 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"