Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQ WWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      276 to 375

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112369 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • JTK 1
    • JTK1
    • Non receptor tyrosine protein kinase 2
    • Non receptor tyrosine protein kinase TYK2
    • Non-receptor tyrosine-protein kinase TYK2
    • OTTHUMP00000232745
    • OTTHUMP00000232746
    • OTTHUMP00000232748
    • Protein Tyrosine Kinase 2
    • TYK 2
    • Tyk2
    • TYK2_HUMAN
    • Tyrosine kinase 2
    see all
  • Function
    Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
  • Tissue specificity
    Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
  • Involvement in disease
    Defects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain
    The FERM domain mediates interaction with JAKMIP1.
  • Information by UniProt

Images

  • ab112369 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab112369 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up