Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP29597
    • SpeciesHuman
    • SequencePVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQ WWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA
    • Molecular weight37 kDa including tags
    • Amino acids276 to 375

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesab112369 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • JTK 1
    • JTK1
    • Non receptor tyrosine protein kinase 2
    • Non receptor tyrosine protein kinase TYK2
    • Non-receptor tyrosine-protein kinase TYK2
    • OTTHUMP00000232745
    • OTTHUMP00000232746
    • OTTHUMP00000232748
    • Protein Tyrosine Kinase 2
    • TYK 2
    • Tyk2
    • TYK2_HUMAN
    • Tyrosine kinase 2
    see all
  • FunctionProbably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
  • Tissue specificityObserved in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
  • Involvement in diseaseDefects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • DomainThe FERM domain mediates interaction with JAKMIP1.
  • Information by UniProt

Recombinant Human TYK2 protein images

  • ab112369 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human TYK2 protein (ab112369)

ab112369 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"