Recombinant Human Tyrosyl tRNA synthetase protein (ab107141)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP54577
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGDAPSPEEKLHLITRNLQEVLGEEKLKEI LKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYL DNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYT LDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVD AQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEES KIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRD EKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNT PALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEK HPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQK MRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEE LKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS
    • Molecular weight61 kDa including tags
    • Amino acids1 to 528
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab107141 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • CMTDIC
    • SYYC_HUMAN
    • Tyrosine tRNA ligase, cytoplasmic
    • Tyrosine tRNA ligase 1, cytoplasmic
    • Tyrosyl tRNA synthetase
    • Tyrosyl--tRNA ligase
    • Tyrosyl-tRNA synthetase, cytoplasmic
    • TyrRS
    • yars
    • YRS
    • YTS
    see all
  • FunctionCatalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).
  • Involvement in diseaseDefects in YARS are the cause of Charcot-Marie-Tooth disease dominant intermediate type C (CMTDIC) [MIM:608323]. CMTDIC is a form of Charcot-Marie-Tooth disease characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
  • Sequence similaritiesBelongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 tRNA-binding domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Tyrosyl tRNA synthetase protein images

  • 15% SDS-PAGE showing ab107141 (3 µg) at approximately 61.3 kDa.

References for Recombinant Human Tyrosyl tRNA synthetase protein (ab107141)

ab107141 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"