Recombinant Human Tyrosyl tRNA synthetase protein (Tagged) (ab190402)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVL GEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTIL FADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQAL DEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSK MSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLD PIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRV GKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVV LCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGY EKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSL KGGNIS
    • Molecular weight
      62 kDa including tags
    • Amino acids
      2 to 528
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_003671.1.

Specifications

Our Abpromise guarantee covers the use of ab190402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NACl, EDTA, KCl, arginine, DTT and glycerol

General Info

  • Alternative names
    • CMTDIC
    • SYYC_HUMAN
    • Tyrosine tRNA ligase, cytoplasmic
    • Tyrosine tRNA ligase 1, cytoplasmic
    • Tyrosyl tRNA synthetase
    • Tyrosyl--tRNA ligase
    • Tyrosyl-tRNA synthetase, cytoplasmic
    • TyrRS
    • yars
    • YRS
    • YTS
    see all
  • Function
    Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).
  • Involvement in disease
    Defects in YARS are the cause of Charcot-Marie-Tooth disease dominant intermediate type C (CMTDIC) [MIM:608323]. CMTDIC is a form of Charcot-Marie-Tooth disease characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 tRNA-binding domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab190402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up