Recombinant Human U2AF1L3 protein (ab165852)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTEL QEKYGEIEEMNVCDNLGDHVVGNVYVKFRREEDGERAVAELSNRWFNGQA VHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGT IGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGS IM
    • Amino acids
      1 to 202
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ35525
    • MGC33901
    • Splicing factor U2AF 26 kDa subunit
    • U2 auxiliary factor 26
    • U2 small nuclear RNA auxiliary factor 1 like 3
    • U2 small nuclear RNA auxiliary factor 1 like 4
    • U2 small nuclear RNA auxiliary factor 1 like protein 3
    • U2 small nuclear RNA auxiliary factor 1 like protein 4
    • U2 small nuclear RNA auxiliary factor 1-like protein 3
    • U2 small nuclear RNA auxiliary factor 1-like protein 4
    • U2(RNU2) small nuclear RNA auxiliary factor 1 like 3
    • U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3
    • U2AF1 like protein 3
    • U2AF1 RS3
    • U2AF1-like protein 3
    • U2AF1L3V1
    • U2AF1L4
    • U2AF1RS3
    • U2af26
    • U2AF4_HUMAN
    • U2RNU2 small nuclear RNA auxiliary factor 1 like 3
    • U2RNU2 small nuclear RNA auxiliary factor 1 like protein 3
    see all
  • Function
    RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participates in the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T cell activation; an event reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site.
  • Tissue specificity
    Isoform 2 is widely expressed. Isoform 3 is highly expressed in heart, brain and lung, lower expressed in thymus and much lower expressed in peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 2 C3H1-type zinc fingers.
    Contains 1 RRM (RNA recognition motif) domain.
  • Domain
    The second zinc finger in necessary for interaction with GFI1 and for alternative pre-mRNA splicing events.
  • Cellular localization
    Nucleus. Nucleus speckle.
  • Information by UniProt

Images

  • ab165852 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up