Recombinant Human U2AF35 protein (ab152778)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLN IYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN VCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDF REACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSR ERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 240

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp313J1712
    • FP793
    • Human U2 snRNP auxiliary factor small subunit9
    • RN
    • RNU2AF1
    • Splicing factor U2AF 35 kDa subunit
    • U2 auxiliary factor 35 kDa subunit
    • U2 small nuclear ribonucleoprotein auxillary factor 35 KD subunit
    • U2 small nuclear RNA auxiliary factor 1
    • U2 snRNP auxiliary factor small subunit
    • U2(RNU2) small nuclear RNA auxiliary factor 1
    • U2(RNU2) small nuclear RNA auxiliary factor binding protein
    • U2AF1
    • U2AF1_HUMAN
    • U2AF35
    • U2AFBP
    see all
  • Function
    Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. Recruits U2 snRNP to the branch point. Directly mediates interactions between U2AF2 and proteins bound to the enhancers and thus may function as a bridge between U2AF2 and the enhancer complex to recruit it to the adjacent intron.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 2 C3H1-type zinc fingers.
    Contains 1 RRM (RNA recognition motif) domain.
  • Domain
    The C-terminal SR-rich domain is required for interactions with SR proteins and the splicing regulators TRA and TRA2, and the N-terminal domain is required for formation of the U2AF1/U2AF2 heterodimer.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Nucleus speckle.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152778 stained with Coomassie Blue.

References

ab152778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up