Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYV LGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWD LGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSF LDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFG DEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREI NGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQD SEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
    • Amino acids
      1 to 389
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E1-L2
    • FLJ10808
    • FLJ23367
    • Monocyte protein 4
    • MOP 4
    • MOP-4
    • MOP4
    • UBA 6
    • Uba6
    • UBA6 ubiquitin activating enzyme E1
    • UBA6_HUMAN
    • UBE1L2
    • Ubiquitin activating enzyme 6
    • Ubiquitin activating enzyme E1 like 2
    • Ubiquitin activating enzyme E1 like protein 2
    • Ubiquitin like modifier activating enzyme 6
    • Ubiquitin-activating enzyme 6
    • Ubiquitin-activating enzyme E1-like protein 2
    • Ubiquitin-like modifier-activating enzyme 6
    see all
  • Function
    Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP. Specific for ubiquitin, does not activate ubiquitin-like peptides. Differs from UBE1 in its specificity for substrate E2 charging. Does not charge cell cycle E2s, such as CDC34. Essential for embryonic development. Required for UBD/FAT10 conjugation. Isoform 2 may play a key role in ubiquitin system and may influence spermatogenesis and male fertility.
  • Tissue specificity
    Widely expressed. Isoform 2 is predominantly expressed in testis with higher expression in adult testis than in fetal testis.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-activating E1 family.
  • Information by UniProt

Images

  • ab163029 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up