Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPN TLYEGGYFKA HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILH PPVDDPQSGELPSERWNPTQNV RTILLSVISLLNEPNTFSPANVDASV MFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG VKVPTTLAEYCIKT KVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 238
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab188723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support conjugation in vitro is 100 nM-1 µM depending on conditions.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 1.19% HEPES, 0.03% DTT, 1.16% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CDC34B
    • E2 CDC34B
    • E2 ubiquitin conjugating enzyme R2
    • FLJ20419
    • MGC10481
    • UB2R2
    • UB2R2_HUMAN
    • UBC3B
    • UBE2R2
    • Ubiquitin carrier protein R2
    • Ubiquitin conjugating enzyme E2 CDC34B
    • Ubiquitin conjugating enzyme E2 R2
    • Ubiquitin conjugating enzyme E2R 2
    • Ubiquitin conjugating enzyme UBC3B
    • Ubiquitin protein ligase R2
    • Ubiquitin-conjugating enzyme E2 R2
    • Ubiquitin-conjugating enzyme E2-CDC34B
    • Ubiquitin-protein ligase R2
    see all
  • Function
    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes monoubiquitination and 'Lys-48'-linked polyubiquitination. May be involved in degradation of katenin.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

References

ab188723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up