Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVY HGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSI RTALLAIIGF
    • Amino acids
      9 to 118
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGI-76
    • HSPC153
    • HSPC205
    • HSU93243
    • HSUBC6e
    • MGC12555
    • NCUBE-1
    • NCUBE1
    • Non-canonical ubiquitin-conjugating enzyme 1
    • UB2J1_HUMAN
    • UBC6
    • UBC6E
    • Ubc6p
    • Ube2j1
    • Ubiquitin conjugating enzyme E2, J1 (UBC6 homolog, yeast)
    • Ubiquitin conjugating enzyme E2, J1, U
    • Ubiquitin-conjugating enzyme E2 J1
    • Yeast ubiquitin-conjugating enzyme UBC6 homolog E
    see all
  • Function
    Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162566 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162566 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162566.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up