Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKN LVLMGVGSLTLHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNR AVQVVVHTGDITEDLLLDFQVVVLTAAKLEEQLKVGTLCHKHGVCFLAAD TRGLVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQGSPGILTLRKGANT HYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEIGDTTTFSRYLRG GAITEVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKF QHLHGRPPQPWDPVDAETVVGLARDLEPLKRTEEEPLEEPLDEALVRTVA LSSAGVLSPMVAMLGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGE LLPSPEDCALRGSRYDGQIAVFGAGFQEKLRRQHYLLVGAGAIGCELLKV FALVGLGAGNSGGLTVVDMDHIERSNLSRQFLFRSQDVGRPKAEVAAAAA RGLNPDLQVIPLTYPLDPTTEHIYGDNFFSRVDGVAAALDSFQARRYVAA RCTHYLKPLLEAGTSGTWGSATVFMPHVTEAYRAPASAAASEDAPYPVCT VRYFPSTAEHTLQWARHEFEELFRLSAETINHHQQAHTSLADMDEPQTLT LLKPVLGVLRVRPQNWQDCVAWALGHWKLCFHYGIKQLLRHFPPNKVLED GTPFWSGPKQCPQPLEFDTNQDTHLLYVLAAANLYAQMHGLPGSQDWTAL RELLKLLPQPDPQQMAPIFASNLELASASAEFGPEQQKELNKALEVWSVG PPLKPLMFEKDDDSNFHVDFVVAAASLRCQNYGIPPVNRAQSKRIVGQII PAIATTTAAVAGLLGLELYKVVSGPRPRSAFRHSYLHLAENYLIRYMPFA PAIQTFHHLKWTSWDRLKVPAGQPERTLESLLAHLQEQHGLRVRILLHGS ALLYAAGWSPEKQAQHLPLRVTELVQQLTGQAPAPGQRVLVLELSCEGDD EDTAFPPLHYEL
    • Molecular weight
      138 kDa including tags
    • Amino acids
      1 to 1012

Specifications

Our Abpromise guarantee covers the use of ab152780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D8
    • MGC12713
    • UBA1, ubiquitin activating enzyme E1 homolog B
    • UBA1B
    • UBA7
    • UBA7, ubiquitin activating enzyme E1
    • UBA7_HUMAN
    • Ube 1L
    • UBE 2
    • UBE1L
    • UBE2
    • Ubiquitin activating enzyme 2
    • Ubiquitin activating enzyme E1 homolog
    • Ubiquitin Activating Enzyme E1 Like
    • Ubiquitin activating enzyme E1 related protein
    • Ubiquitin-activating enzyme 7
    • Ubiquitin-activating enzyme E1 homolog
    • ubiquitin-activating enzyme-2
    • ubiquitin-like modifier activating enzyme 7
    • Ubiquitin-like modifier-activating enzyme 7
    see all
  • Function
    Activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP.
  • Tissue specificity
    Expressed in a variety of normal and tumor cell types, but is reduced in lung cancer cell lines.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-activating E1 family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152780 stained with Coomassie Blue.

References

ab152780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up