Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMHHHHHHAMGQLRSMSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQW NAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGS ICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKRE YEKRVSAIVEQSWNDS
    • Additional sequence informationUbiquitin Conjugating Enzyme E2B Human Recombinant produced in E.coli is a 19 kDa protein containing 166 amino acids.

Specifications

Our Abpromise guarantee covers the use of ab73536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab73536 is purified by proprietary chromatographic techniques. Purity greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • FormLyophilised
  • Additional notesLyophilized Ube2B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 1mM DTT, 1X PBS, pH 7.5

  • ReconstitutionReconstitute the lyophilized Ube2B in sterile water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions

General Info

  • Alternative names
    • E2 17kDa
    • E2 protein
    • hHR6B
    • HR6B
    • RAD6 homolog B
    • RAD6B
    • UBC2
    • UBE2B
    • UBE2B_HUMAN
    • Ubiquitin carrier protein B
    • Ubiquitin conjugating enzyme E2 B
    • Ubiquitin conjugating enzyme E2B
    • Ubiquitin conjugating enzyme E2B (RAD6 homolog)
    • Ubiquitin protein ligase B
    • Ubiquitin-conjugating enzyme E2 17 kDa
    • Ubiquitin-conjugating enzyme E2 B
    • Ubiquitin-conjugating enzyme E2-17 kDa
    • Ubiquitin-protein ligase B
    see all
  • FunctionAccepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'- and 'Lys-63'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. Associates to the E3 ligase RAD18 to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. May be involved in neurite outgrowth.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesBelongs to the ubiquitin-conjugating enzyme family.
  • Cellular localizationCell membrane. Nucleus. In peripheral neurons, expressed both at the plasma membrane and in nuclei.
  • Information by UniProt

References for Recombinant Human Ube2B protein (ab73536)

ab73536 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"