Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHHHHHHAMGQLRSMSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQW NAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGS ICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKRE YEKRVSAIVEQSWNDS
    • Additional sequence information
      Ubiquitin Conjugating Enzyme E2B Human Recombinant produced in E.coli is a 19 kDa protein containing 166 amino acids.

Specifications

Our Abpromise guarantee covers the use of ab73536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab73536 is purified by proprietary chromatographic techniques. Purity greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized Ube2B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 1mM DTT, 1X PBS, pH 7.5

  • Reconstitution
    Reconstitute the lyophilized Ube2B in sterile water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions

General Info

  • Alternative names
    • E2 17kDa
    • E2 protein
    • hHR6B
    • HR6B
    • RAD6 homolog B
    • RAD6B
    • UBC2
    • UBE2B
    • UBE2B_HUMAN
    • Ubiquitin carrier protein B
    • Ubiquitin conjugating enzyme E2 B
    • Ubiquitin conjugating enzyme E2B
    • Ubiquitin conjugating enzyme E2B (RAD6 homolog)
    • Ubiquitin protein ligase B
    • Ubiquitin-conjugating enzyme E2 17 kDa
    • Ubiquitin-conjugating enzyme E2 B
    • Ubiquitin-conjugating enzyme E2-17 kDa
    • Ubiquitin-protein ligase B
    see all
  • Function
    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'- and 'Lys-63'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. Associates to the E3 ligase RAD18 to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. May be involved in neurite outgrowth.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Cell membrane. Nucleus. In peripheral neurons, expressed both at the plasma membrane and in nuclei.
  • Information by UniProt

References

ab73536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up