Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGP PGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQ WTKRYAT
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 207
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names
    • Homologous to yeast UBC4/5
    • UB2E3_HUMAN
    • UBC E4
    • Ubc M2
    • UBC4/5 homolog
    • UBCE 4
    • UBCE4
    • UBCH 9
    • UbcH9
    • UbcM2
    • UBE2 E3
    • UBE2E3
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein E3
    • Ubiquitin conjugating enzyme E2 23 kDa
    • Ubiquitin conjugating enzyme E2 E3
    • Ubiquitin conjugating enzyme E2E 3
    • Ubiquitin conjugating enzyme E2E 3 (homologous to yeast UBC4/5)
    • Ubiquitin conjugating enzyme E2E 3 (UBC4/5 homolog, yeast
    • Ubiquitin conjugating enzyme UBCH 9
    • Ubiquitin conjugating enzyme UBCH9
    • Ubiquitin protein ligase
    • Ubiquitin protein ligase E3
    • Ubiquitin-conjugating enzyme E2 E3
    • Ubiquitin-conjugating enzyme E2-23 kDa
    • Ubiquitin-protein ligase E3
    see all
  • Function
    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.
  • Tissue specificity
    Ubiquitously expressed at low levels. Highly expressed in skeletal muscle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167930.

References

ab167930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up