Recombinant Human UBE2E3 protein (ab88285)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK LSSKTTAK LSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTIL GPPGSVYEGGVFFLDITF SSDYPFKPPKVTFRTRIYHCNINSQGVICL DILKDNWSPALTISKVLLSICSLLTDCN PADPLVGSIATQYLTNRAEH DRIARQWTKRYAT

Specifications

Our Abpromise guarantee covers the use of ab88285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88285 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Homologous to yeast UBC4/5
    • UB2E3_HUMAN
    • UBC E4
    • Ubc M2
    • UBC4/5 homolog
    • UBCE 4
    • UBCE4
    • UBCH 9
    • UbcH9
    • UbcM2
    • UBE2 E3
    • UBE2E3
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein E3
    • Ubiquitin conjugating enzyme E2 23 kDa
    • Ubiquitin conjugating enzyme E2 E3
    • Ubiquitin conjugating enzyme E2E 3
    • Ubiquitin conjugating enzyme E2E 3 (homologous to yeast UBC4/5)
    • Ubiquitin conjugating enzyme E2E 3 (UBC4/5 homolog, yeast
    • Ubiquitin conjugating enzyme UBCH 9
    • Ubiquitin conjugating enzyme UBCH9
    • Ubiquitin protein ligase
    • Ubiquitin protein ligase E3
    • Ubiquitin-conjugating enzyme E2 E3
    • Ubiquitin-conjugating enzyme E2-23 kDa
    • Ubiquitin-protein ligase E3
    see all
  • FunctionAccepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.
  • Tissue specificityUbiquitously expressed at low levels. Highly expressed in skeletal muscle.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesBelongs to the ubiquitin-conjugating enzyme family.
  • Cellular localizationNucleus. Cytoplasm. Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner.
  • Information by UniProt

References for Recombinant Human UBE2E3 protein (ab88285)

ab88285 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

The protein ab88285 has not been tested for activity. The tag is located at its N terminal.

The protein ab127408 has been tested in a ubiquitin conjugation assay and found to be active.

I hope thi...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"