Recombinant human Ube2G1 protein (ab188725)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY EGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGED KYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRN GEFKRKVARCVRKSQETAFE
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 170
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab188725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support conjugation in vitro is 100 nM-1 µM depending on conditions.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 0.03% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • E217K
    • UB2G1_HUMAN
    • UBC 7
    • UBC7
    • UBC7 homolog yeast
    • UBE 2G
    • UBE2G
    • Ube2g1
    • Ubiquitin carrier protein G1
    • Ubiquitin conjugating enzyme E2 G1
    • Ubiquitin conjugating enzyme E2G 1
    • Ubiquitin conjugating enzyme E2G 1 (homologous to C. elegans UBC7)
    • Ubiquitin conjugating enzyme E2G 1 (UBC7 homolog C. elegans)
    • Ubiquitin conjugating enzyme E2G 1 (UBC7 homolog yeast)
    • Ubiquitin protein ligase G1
    • Ubiquitin-conjugating enzyme E2 G1
    • Ubiquitin-protein ligase G1
    see all
  • Function
    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. May be involved in degradation of muscle-specific proteins. Mediates polyubiquitination of CYP3A4.
  • Tissue specificity
    Widely expressed, mainly in skeletal muscle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

References

ab188725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up