Recombinant Human UBE2I / UBC9 protein (BSA and azide free) (ab173073)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFG FVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPP KCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEP NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 1.19% HEPES, 0.88% Sodium chloride

General Info

  • Alternative names
    • C358B7.1
    • p18
    • SUMO 1 protein ligase
    • SUMO conjugating enzyme UBC9
    • SUMO-conjugating enzyme UBC9
    • SUMO-protein ligase
    • SUMO1 protein ligase
    • UBC9
    • UBC9_HUMAN
    • UBCE9
    • Ube2i
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein 9
    • Ubiquitin carrier protein I
    • Ubiquitin conjugating enzyme 9
    • Ubiquitin conjugating enzyme E2I (homologous to yeast UBC9)
    • Ubiquitin conjugating enzyme E2I (UBC9 homolog, yeast)
    • Ubiquitin conjugating enzyme UbcE2A
    • Ubiquitin like protein SUMO 1 conjugating enzyme
    • Ubiquitin protein ligase E2I
    • Ubiquitin-conjugating enzyme E2 I
    • Ubiquitin-protein ligase I
    see all
  • Function
    Accepts the ubiquitin-like proteins SUMO1, SUMO2, SUMO3 and SUMO4 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2 or CBX4. Necessary for sumoylation of FOXL2 and KAT5. Essential for nuclear architecture and chromosome segregation.
  • Tissue specificity
    Expressed in heart, skeletal muscle, pancreas, kidney, liver, lung, placenta and brain. Also expressed in testis and thymus.
  • Pathway
    Protein modification; protein sumoylation.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Nucleus. Cytoplasm. Mainly nuclear. In spermatocytes, localizes in synaptonemal complexes. Recruited by BCL11A into the nuclear body.
  • Information by UniProt

References

ab173073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up