Recombinant human UBE2Q1 protein (ab188726)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLES IFHRGHERFRIASACLDELSCEFLLAGAGGAGAGAAPGPHLPPRGSVPGD PVRIHCNITESYPAVPPIWSVESDDPNLAAVLERLVDIKKGNTLLLQHLK RIISDLCKLYNLPQHPDVEMLDQPLPAEQCTQEDVSSEDEDEEMPEDTED LDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSV QATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALH NDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAI CMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQ SYKSLVQIHEKNGWYTPPKEDG
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 422
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab188726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support conjugation in vitro is 100 nM-1 µM depending on conditions.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 1.19% HEPES, 1.16% Sodium chloride, 0.03% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Galactosyl transferase associated protein
    • GTAP
    • NICE 5
    • NICE5
    • OTTHUMP00000035378
    • PRO3094
    • Protein NICE 5
    • Protein NICE-5
    • UB2Q1_HUMAN
    • UBE2Q
    • Ube2q1
    • Ubiquitin carrier protein Q1
    • Ubiquitin conjugating enzyme E2 Q1
    • Ubiquitin conjugating enzyme E2Q (putative) 1
    • Ubiquitin conjugating enzyme E2Q 1
    • Ubiquitin conjugating enzyme E2Q family member 1
    • Ubiquitin protein ligase Q1
    • Ubiquitin-conjugating enzyme E2 Q1
    • Ubiquitin-protein ligase Q1
    see all
  • Function
    Catalyzes the covalent attachment of ubiquitin to other proteins.
  • Tissue specificity
    Widely expressed.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

References

ab188726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up