Recombinant Human UBE2Q2 protein (ab164921)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLP PPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLK WLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED IEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVS GSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDS PLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGG GALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLAR AQQSYNSIVQIHEKNGWYTPPKEDG
    • Amino acids
      1 to 375
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LOC92912
    • UB2Q2_HUMAN
    • UBE2Q2
    • Ubiquitin carrier protein Q2
    • Ubiquitin conjugating enzyme E2Q 2
    • Ubiquitin conjugating enzyme E2Q family member 2
    • Ubiquitin-conjugating enzyme E2 Q2
    • ubiquitin-conjugating enzyme E2Q (putative) 2
    • Ubiquitin-protein ligase Q2
    see all
  • Function
    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.
  • Tissue specificity
    Detected in hypopharyngeal head and neck squamous cell carcinoma, in tumor masses and invasive epithelium.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164921 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up