Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHGRAYLLLHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQG LVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWN TNYTLSSILLALQVMLSNPVLENPVNLEAARILVKDESLYRTILRLFNRP LQMKDDSQELPKDPRKCIRPIKTTSFSDYYQTWSRIATSKATEYYRTPLL KVPNFIGQYYKWKKMDLQHQKEWNLK
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 226
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab174061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • RP4-636O23.1
    • UBE2U
    • UBE2U_HUMAN
    • Ubiquitin carrier protein U
    • Ubiquitin conjugating enzyme E2U (putative)
    • Ubiquitin-conjugating enzyme E2 U
    • Ubiquitin-protein ligase U
    see all
  • Function
    Catalyzes the covalent attachment of ubiquitin to other proteins.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • SDS-PAGE showing ab174061

References

ab174061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up