Recombinant Human UBE2V1 protein (BSA and azide free) (ab173080)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTG MIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVV DPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEH HHHHH
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 147
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 9
    Constituents: 1.19% HEPES, 0.58% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • CIR1
    • CROC-1
    • CROC1
    • CROC1A
    • TRAF6-regulated IKK activator 1 beta Uev1A
    • UB2V1_HUMAN
    • UBE2V
    • UBE2V 1
    • UBE2V1
    • Ubiquitin conjugating enzyme E2 variant 1
    • Ubiquitin-conjugating enzyme E2 variant 1
    • UEV-1
    • UEV1
    see all
  • Function
    Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
  • Tissue specificity
    Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Nucleus. Excluded from the nucleolus.
  • Information by UniProt

References

ab173080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up