Overview

  • Product name
    Recombinant Human UBE3B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VSLACSKDLTLLWIQQIKNILWYCCDFLKQLKPEILQDSRLITLYLTMLV TFTDTSTWKILRGKGESLRPAMNHICANIMGHLNQHGFYSVLQILLTRGL ARPRPCLS
    • Amino acids
      118 to 225
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI449831
    • AU020130
    • FLJ45294
    • MGC131858
    • MGC78388
    • Ubiquitin protein ligase E3B
    see all
  • Relevance
    UBE3B accepts ubiquitin from an E2 ubiquitin conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. UBE3B may interact with other proteins and play a role in stress response. Alternatively spliced transcript variants encoding the same protein isoform have been identified for this gene.

Images

  • ab164801 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up