Overview

  • Product name
    Recombinant Human UBE4B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIM DRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
    • Amino acids
      1075 to 1173
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4930551I19Rik
    • 4933406G05Rik
    • AU014668
    • D4Bwg0973e
    • E4
    • HDNB1
    • Homozygously deleted in neuroblastoma 1
    • KIAA0684
    • mKIAA0684
    • RP23 173D8.1
    • Ube4b
    • UBE4B_HUMAN
    • Ubiquitin conjugation factor E4 B
    • Ubiquitin fusion degradation protein 2
    • UBOX3
    • UFD2
    • UFD2a
    • Ufd2p
    see all
  • Function
    Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3.
  • Tissue specificity
    Highest expression in ovary, testis, heart and skeletal muscle. Expression is low in colon, thymus and peripheral blood leukocytes. Almost undetectable in lung and spleen.
  • Sequence similarities
    Belongs to the ubiquitin conjugation factor E4 family.
    Contains 1 U-box domain.
  • Post-translational
    modifications
    Proteolytically cleaved by caspases during apoptosis. Cleaved efficiently at Asp-123 by caspase-6 and granzyme B. Cleaved with approximately 10-fold less efficiency at Asp-109 by caspase-3 and caspase-7.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160923 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up