Recombinant Human UBIAD1 protein (ab162257)

Overview

  • Product name
    Recombinant Human UBIAD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYV LALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNL VNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLY YLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVM FAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAI LIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQF RSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI
    • Amino acids
      1 to 338
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • RP4-796F18.1
    • SCCD
    • TERE 1
    • tere1
    • Transitional epithelia response protein
    • Transitional epithelial response protein 1
    • UbiA prenyltransferase domain containing 1
    • UbiA prenyltransferase domain containing protein 1
    • UbiA prenyltransferase domain-containing protein 1
    • UBIA1_HUMAN
    • UBIAD 1
    • Ubiad1
    see all
  • Function
    Prenyltransferase that mediates the formation of menaquinone-4 (MK-4), a vitamin K2 isoform present at high concentrations in the brain, kidney and pancreas. Mediates the conversion of phylloquinone (PK) into menaquinone-4 (MK-4), probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4.
  • Tissue specificity
    Ubiquitously expressed.
  • Pathway
    Cofactor biosynthesis; menaquinone biosynthesis.
  • Involvement in disease
    Defects in UBIAD1 are the cause of crystalline corneal dystrophy of Schnyder (SCCD) [MIM:121800]. SCCD is a rare autosomal dominant disease characterized by progressive corneal opacification resulting from abnormal deposition of cholesterol and phospholipids.
  • Sequence similarities
    Belongs to the ubiA prenyltransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane. Cytoplasm. Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • ab162257 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up