Overview

  • Product name
    Recombinant Human UBL3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSNVPADMINLRLILVSGKTKEFLFSPND SASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPF GKTTVMHLVARETLPEPNSQGQRNREKTGESNCC
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 114
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109342 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • DKFZp434K151
    • FLJ32018
    • HCG 1
    • HCG1
    • HsMUB
    • Membrane-anchored ubiquitin-fold protein
    • MUB
    • OTTHUMP00000018193
    • PNSC1
    • Protein HCG 1
    • Protein HCG-1
    • Ubiquitin like 3
    • Ubiquitin like protein 3
    • Ubiquitin-like protein 3
    • UBL3
    • UBL3_HUMAN
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 ubiquitin-like domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109342.

References

ab109342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up