Overview

  • Product nameRecombinant Human UBL3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95164
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSNVPADMINLRLILVSGKTKEFLFSPND SASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPF GKTTVMHLVARETLPEPNSQGQRNREKTGESNCC
    • Molecular weight15 kDa including tags
    • Amino acids1 to 114
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109342 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • DKFZp434K151
    • FLJ32018
    • HCG 1
    • HCG1
    • HsMUB
    • Membrane-anchored ubiquitin-fold protein
    • MUB
    • OTTHUMP00000018193
    • PNSC1
    • Protein HCG 1
    • Protein HCG-1
    • Ubiquitin like 3
    • Ubiquitin like protein 3
    • Ubiquitin-like protein 3
    • UBL3
    • UBL3_HUMAN
    see all
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 ubiquitin-like domain.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human UBL3 protein images

  • 15% SDS-PAGE analysis of 3 µg ab109342.

References for Recombinant Human UBL3 protein (ab109342)

ab109342 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"