Overview

  • Product nameRecombinant Human UBL4A protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP11441
    • SpeciesHuman
    • SequenceMQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKAL ADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLIS KVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTET MEKGFSKLEHHHHHH
    • Molecular weight19 kDa including tags
    • Amino acids1 to 157
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab123144 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • DX254E
    • DXS254E
    • G6PD
    • GDX
    • OTTHUMP00000061462
    • Ubiquitin like 4
    • Ubiquitin like 4A
    • Ubiquitin like protein 4A
    • Ubiquitin like protein GDX
    • Ubiquitin-like protein 4A
    • Ubiquitin-like protein GDX
    • UBL 4
    • UBL 4A
    • UBL4
    • Ubl4a
    • UBL4A_HUMAN
    see all
  • FunctionComponent of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
  • Sequence similaritiesContains 1 ubiquitin-like domain.
  • Cellular localizationCytoplasm > cytosol.
  • Information by UniProt

Recombinant Human UBL4A protein images

  • 12% SDS PAGE, 3 µg of ab123144 loaded.

References for Recombinant Human UBL4A protein (ab123144)

ab123144 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"