Overview

  • Product name
    Recombinant Human UBL4A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKAL ADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLIS KVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTET MEKGFSKLEHHHHHH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 157
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123144 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • DX254E
    • DXS254E
    • G6PD
    • GDX
    • OTTHUMP00000061462
    • Ubiquitin like 4
    • Ubiquitin like 4A
    • Ubiquitin like protein 4A
    • Ubiquitin like protein GDX
    • Ubiquitin-like protein 4A
    • Ubiquitin-like protein GDX
    • UBL 4
    • UBL 4A
    • UBL4
    • Ubl4a
    • UBL4A_HUMAN
    see all
  • Function
    Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
  • Sequence similarities
    Contains 1 ubiquitin-like domain.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • 12% SDS PAGE, 3 µg of ab123144 loaded.

References

ab123144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up