Overview

  • Product nameRecombinant Human UBL5 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BZL1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKL IAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
    • Molecular weight11 kDa including tags
    • Amino acids1 to 73
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109343 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ46917
    • HUB1
    • MGC131795
    • Ubiquitin like 5
    • Ubiquitin like protein 5
    • Ubiquitin-like protein 5
    • Ubl5
    • UBL5_HUMAN
    see all
  • Tissue specificityUbiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts.
  • Sequence similaritiesContains 1 ubiquitin-like domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human UBL5 protein images

  • 15% SDS-PAGE analysis of 3 µg ab109343.

References for Recombinant Human UBL5 protein (ab109343)

ab109343 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"