Recombinant Human UBLCP1 protein (ab202175)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMALPIIVKWGGQEYSVTTLSEDDTVLD LKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGT REESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKV EILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDY DIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLI DVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLN RDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 318
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_659486

Specifications

Our Abpromise guarantee covers the use of ab202175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • CPUB1
    • CTD like phosphatase domain containing protein
    • CTD phosphatase like with ubiquitin domain 1
    • FLJ25267
    • MGC10067
    • Nuclear proteasome inhibitor UBLCP1
    • UBCP1_HUMAN
    • Ubiquitin like domain containing CTD phosphatase 1
    • Ubiquitin-like domain-containing CTD phosphatase 1
    • UBLCP1
    see all
  • Function
    Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.
  • Tissue specificity
    Broadly expressed, with highest levels in placenta, lung, testis and ovary. Up-regulated in tumor tissues.
  • Sequence similarities
    Contains 1 FCP1 homology domain.
    Contains 1 ubiquitin-like domain.
  • Domain
    The Ubiquitin-like domain mediates interaction with proteasomes.
  • Cellular localization
    Nucleus. Colocalizes with nuclear proteasomes.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202175 (3 µg).

References

ab202175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up