Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDY PHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVP FQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNL IKDQITDVHLVERLQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFD VDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQ TLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG QYELFAVIAHVGMADSGHYCVYIRNAVDGKWLCFNDSNICLVSWEDIQCT YGNPNYHWQETAYLLVYMKMEC
    • Amino acids
      1 to 372
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 43 kDa ISG15 specific protease
    • 43 kDa ISG15-specific protease
    • EC 3.1.2.
    • hUBP43
    • Interferon Stimulated Gene 43 kD
    • ISG15 Specific Processing Protease
    • ISG15-specific-processing protease
    • ISG43
    • Ubiquitin Specific Peptidase 18
    • Ubiquitin Specific Protease 18
    • Ubiquitin Specific Protease 18 43 kD
    • Ubl carboxyl terminal hydrolase 18
    • Ubl carboxyl-terminal hydrolase 18
    • Ubl thioesterase 18
    • Ubl thiolesterase 18
    • Ubp15
    • UBP18_HUMAN
    • USP18
    see all
  • Function
    Can efficiently cleave only ISG15 fusions including native ISG15 conjugates linked via isopeptide bonds. Necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.
  • Sequence similarities
    Belongs to the peptidase C19 family.
  • Information by UniProt

Images

  • ab161389 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up