Overview

  • Product name
    Recombinant Human UBR1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIY FAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase UBR1
    • JBS
    • N-recognin-1
    • ubiquitin protein ligase E3 component n-recognin 1
    • Ubiquitin-protein ligase E3-alpha-1
    • Ubiquitin-protein ligase E3-alpha-I
    • UBR1
    • UBR1_HUMAN
    see all
  • Function
    E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. May be involved in pancreatic homeostasis. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth.
  • Tissue specificity
    Broadly expressed, with highest levels in skeletal muscle, kidney and pancreas. Present in acinar cells of the pancreas (at protein level).
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in UBR1 are a cause of Johanson-Blizzard syndrome (JBS) [MIM:243800]. This disorder includes congenital exocrine pancreatic insufficiency, multiple malformations such as nasal wing aplasia, and frequent mental retardation. Pancreas of individuals with JBS do not express UBR1 and show intrauterine-onset destructive pancreatitis.
  • Sequence similarities
    Belongs to the UBR1 family.
    Contains 1 RING-type zinc finger.
    Contains 1 UBR-type zinc finger.
  • Developmental stage
    Expressed in fetal pancreas.
  • Domain
    The RING-H2 zinc finger is an atypical RING finger with a His ligand in place of the fourth Cys of the classical motif.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • ab165841 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up