Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIY CRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG RVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCD CGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFR YAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAV NCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKV QVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSS LVDRLMLSDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYERLQ SDYVTDDHDREFSVADLSVQIFTVPSLFSISAGRSGSPL
    • Amino acids
      1 to 439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA49A4.1
    • C6orf133
    • dJ242G1.1
    • dJ392M17.3
    • DKFZp686C08114
    • E3 ubiquitin protein ligase UBR2
    • KIAA0349
    • MGC71112
    • N recognin 2
    • OTTHUMP00000016403
    • OTTHUMP00000039767
    • OTTHUMP00000039768
    • RP3 392M17.3
    • Ubiquitin ligase E3 alpha II
    • Ubiquitin protein ligase E3 alpha 2
    • Ubiquitin protein ligase E3 alpha II
    • Ubiquitin protein ligase E3 component n recognin 2
    • UBR 2
    see all
  • Relevance
    UBR2 (Ubiquitin protein ligase E3 component n-recognin 2) is an E3 ubiquitin-protein ligase involved in the N-end rule pathway. It recognizes and binds to proteins with destabilizing N-terminal residues (an N-terminal degron), leading to their ubiquitination and subsequent degradation.
  • Cellular localization
    Nuclear

Images

  • ab161596 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up