Overview

  • Product name
    Recombinant Human UBR4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRL DRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ
    • Amino acids
      94 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 600 kDa retinoblastoma protein associated factor
    • 600 kDa retinoblastoma protein-associated factor
    • E3 ubiquitin-protein ligase UBR4
    • KIAA0462
    • KIAA1307
    • N-recognin-4
    • p600
    • RBAF600
    • Retinoblastoma associated factor 600 like protein
    • Retinoblastoma associated factor of 600 kDa
    • Retinoblastoma-associated factor 600
    • Retinoblastoma-associated factor of 600 kDa
    • Ubiquitin protein ligase E3 component n recognin 4
    • UBR4
    • UBR4_HUMAN
    • Zinc finger UBR1 type protein 1
    • Zinc finger UBR1-type protein 1
    • Zinc finger, UBR1 type 1
    • ZUBR 1
    • ZUBR1
    see all
  • Function
    E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Regulates integrin-mediated signaling. May play a role in activation of FAK in response to cell-matrix interactions.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the UBR4 family.
    Contains 1 UBR-type zinc finger.
  • Cellular localization
    Membrane. Cytoplasm. Cytoplasm > cytoskeleton. Nucleus. Concentrates at the leading edge of membrane structures involved in actin motility.
  • Information by UniProt

Images

  • ab153218 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up