Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTGNAGEWCLMESDPGVFTELIKGFGCRGA QVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFA KQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLAL SNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMI YEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 329
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: > 500 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.
    Activity Assay:
    1. Prepare a 100ul of recombinant UCH-L5 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.)
  • Add 50ul of 1µM Ubiquitin-AMC.
  • Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.
    - Ubiquitin-AMC
    - 96 Well Polystyrene Microplate, black
    - Fluorescent plate reader (PerkinElmer, VICTOR X3)
  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab108375 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, 2mM EDTA, 0.1mM PMSF, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • UCH37
    • AD-019
    • CGI 70
    • INO80 complex subunit R
    • INO80R
    • Ubiquitin C terminal hydrolase L5
    • Ubiquitin C terminal hydrolase UCH37
    • Ubiquitin C-terminal hydrolase UCH37
    • Ubiquitin carboxyl terminal esterase L5
    • Ubiquitin carboxyl terminal hydrolase isozyme L5
    • Ubiquitin carboxyl terminal hydrolase L5
    • Ubiquitin carboxyl-terminal hydrolase isozyme L5
    • Ubiquitin thioesterase L5
    • Ubiquitin thiolesterase L5
    • UCH L5
    • UCH-L5
    • UCHL5
    • UCHL5_HUMAN
    see all
  • Function
    Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome.
  • Sequence similarities
    Belongs to the peptidase C12 family.
  • Cellular localization
    Cytoplasm. Nucleus. Associates with the proteasome 19S subunit in the cytoplasm. Associates with the INO80 complex in the nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab108375 (3µg)

References

ab108375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up