Recombinant human UCHL3 protein (ab103502)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human UCHL3 protein
See all UCHL3 proteins and peptides -
Biological activity
Specific activity: >3,000 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.
Activity Assay:- Prepare a 100ul of recombinant UCH-L3 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.)
- Add 50ul of 1uM Ubiquitin-AMC.
- Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.
- Ubiquitin-AMC
- 96 Well Polystyrene Microplate, black
- Fluorescent plate reader (PerkinElmer, VICTOR X3)
Specific activity: >3,000 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.
Activity Assay:- Prepare a 100ul of recombinant UCH-L3 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.)
- Add 50ul of 1uM Ubiquitin-AMC.
- Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.
- Ubiquitin-AMC
- 96 Well Polystyrene Microplate, black
- Fluorescent plate reader (PerkinElmer, VICTOR X3)
-
Purity
> 95 % SDS-PAGE.
ab103502 purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMEGQRWLPLEANPEVTNQFLKQLGLHPNWQ FVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDV TSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMS PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA -
Predicted molecular weight
28 kDa including tags -
Amino acids
1 to 230 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab103502 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% GlycerolThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Ubiquitin carboxyl-terminal hydrolase isozyme L3
- Ubiquitin thioesterase L3
- Ubiquitin thiolesterase
see all -
Function
Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. -
Tissue specificity
Highly expressed in heart, skeletal muscle, and testis. -
Sequence similarities
Belongs to the peptidase C12 family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab103502 has not yet been referenced specifically in any publications.