Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC AVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGL IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHET SAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDET LLEDAIEVCKKFMERDPDELRFNAIALSAA
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 230
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    Assessed by densitometry.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.74% Sodium chloride

General Info

  • Alternative names
    • Ubiquitin carboxyl-terminal hydrolase isozyme L3
    • Ubiquitin thioesterase L3
    • Ubiquitin thiolesterase
    • Ubiquitin thiolesterase L3
    • UCH L3
    • UCH-L3
    • UCHL3
    • UCHL3_HUMAN
    see all
  • Function
    Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3". Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory.
  • Tissue specificity
    Highly expressed in heart, skeletal muscle, and testis.
  • Sequence similarities
    Belongs to the peptidase C12 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS Page analysis of ab167959

References

ab167959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up