Recombinant Human UCHL5IP protein (ab163123)

Overview

  • Product name
    Recombinant Human UCHL5IP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNC PFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGV PTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSL TIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQ PLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQH EQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPD LHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWG GSSSVMSLATKMNELMEK
    • Amino acids
      1 to 368
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome-associated UCH interacting protein 1
    • 26S proteasome-associated UCH37-interacting protein 1
    • Expressed-Xq28STS protein
    • HAUS augmin-like complex subunit 7
    • Haus7
    • HAUS7_HUMAN
    • HSXQ28ORF
    • UCH37 interacting protein 1
    • UCHL5 interacting protein
    • UCHL5-interacting protein
    • UCHL5IP
    • UIP1
    • X-linked protein STS1769
    see all
  • Function
    Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
  • Tissue specificity
    Detected in spleen, thymus, testis, ovary, small intestine and colon, with highest levels of expression in testis and ovary.
  • Sequence similarities
    Belongs to the HAUS7 family.
  • Cellular localization
    Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Localizes to interphase centrosomes and to mitotic spindle microtubules.
  • Information by UniProt

Images

  • ab163123 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up