Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRT FSEPGDHPGMLTSGKRSHLESSSRP
    • Amino acids
      202 to 276
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytidine monophosphate kinase
    • Cytidine monophosphokinase 1
    • Cytidylate kinase
    • Deoxycytidylate kinase
    • FLJ12255
    • OTTHUMP00000022400
    • OTTHUMP00000022401
    • OTTHUMP00000022403
    • OTTHUMP00000022404
    • RP11-334J6.5
    • UCK 1
    • uck1
    • UCK1_HUMAN
    • UMP-CMP kinase
    • Uridine monophosphokinase 1
    • Uridine-cytidine kinase 1
    • Uridine/cytidine kinase 1
    • URK1
    see all
  • Function
    Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Pyrimidine metabolism; CTP biosynthesis via salvage pathway; CTP from cytidine: step 1/3.
    Pyrimidine metabolism; UMP biosynthesis via salvage pathway; UMP from uridine: step 1/1.
  • Sequence similarities
    Belongs to the uridine kinase family.
  • Information by UniProt

Images

  • ab164407 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up