Overview

  • Product nameRecombinant Human UCK2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BZX2
    • SpeciesHuman
    • SequenceMAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVD YRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKE ITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQ MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPT KKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRK RQASESSSRPHLEHHHHHH
    • Molecular weight30 kDa including tags
    • Amino acids1 to 261
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab102023 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 1mM EDTA, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • Cytidine monophosphokinase 2
    • TSA903
    • UCK2
    • UK
    • UMPK
    • Uridine cytidine kinase 2
    • Uridine monophosphokinase 2
    see all
  • RelevanceUCK2 phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides.
  • Cellular localizationCytosol

Recombinant Human UCK2 protein images

  • 15% SDS-PAGE analysis of 3µg ab102023.

References for Recombinant Human UCK2 protein (ab102023)

ab102023 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"