Overview

  • Product name
    Recombinant Human UCN2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSA APTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQAT TNARILARVGHC
    • Amino acids
      1 to 112
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SRP
    • Stresscopin related peptide
    • UCN II
    • UCNI
    • UCNII
    • UR
    • Urocortin II
    • Urocortin related peptide
    • URP
    see all
  • Relevance
    UCN2 belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. It suppresses food intake, delays gastric emptying and decreases heat-induced edema. UCN2 might represent an endogenous ligand for maintaining homeostasis after stress. A powerful cytoprotective effect of urocortin peptide administration against ischemia and reperfusion injury has been demonstrated in isolated cardiomyocyte models, as well as in the intact heart both in vitro and in vivo.
  • Cellular localization
    Secreted.

Images

  • ab164813 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up